PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 422aa    MW: 47825 Da    PI: 6.5818
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24981genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31246300155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                k+r+rWt++LHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Tp57577_TGAC_v2_mRNA24981 246 KTRIRWTQDLHEKFVECVNRLGGAEKATPKAILRLMESDGLTIFHVKSHLQKYRI 300
                                68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.814243303IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-28244301IPR009057Homeodomain-like
SuperFamilySSF466897.7E-17244300IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23246301IPR006447Myb domain, plants
PfamPF002492.2E-8250299IPR001005SANT/Myb domain
PfamPF143795.2E-20330375IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MNENKIDYLG RIQQNHILNG DFNSELGNCS SQYFDIRNAS NIGNFSQQYS MEQSPYIVQS  60
QNQGVQGKSS SNTIISRFES PTSAFYATEI CMGFPQYDYQ QVGNNNNGFQ QFSNKVNDLE  120
FPLYQCPREN NNLYLDSTNQ TTSHNFELSN LNTLQPLIRS QLNSDQCCRS PEKSNGGNFL  180
FIDDAATISM SPLIHSNGNH DHKVSCGSYD FPVSQLNFSY QQEKLSPSMS TCSGNHVSNG  240
SSVSSKTRIR WTQDLHEKFV ECVNRLGGAE KATPKAILRL MESDGLTIFH VKSHLQKYRI  300
AKYMPEPAQG KSEKRTHVEN VNLDVKSGLQ IREALQLQLD VQRRLHEQLE IQRKLQLRIE  360
EQGKQLKMMF DQQQKRSSSD QLDTQNLDNT SNNDKPISPK DIEASIFEGS ENNPLFPSKI  420
S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1387131e-80BT138713.1 Medicago truncatula clone JCVI-FLMt-8G17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467656.10.0myb-like transcription factor family protein
TrEMBLA0A072VJR90.0A0A072VJR9_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA09G17404.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.14e-70G2-like family protein